Glycoprotein 42, Recombinant, Epstein-Barr virus, aa34-223, His-Tag

Catalog Number: USB-584708
Article Name: Glycoprotein 42, Recombinant, Epstein-Barr virus, aa34-223, His-Tag
Biozol Catalog Number: USB-584708
Supplier Catalog Number: 584708
Alternative Catalog Number: USB-584708-20,USB-584708-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays a role in virion attachment to host B-lymphocytes, through binding to leukocyte antigen (HLA) class II and subsequently participates in fusion of the virion with host membranes. May act as a tropism switch that directs fusion with B-lymphocytes and inhibits fusion with epithelial cells. Source: Recombinant protein corresponding to aa34-223 from Epstein-Barr virus Glycoprotein 42, fused to 6X His-Tag at N-terminal and 6X His-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~28.3kD Amino Acid Sequence: GGRVAAAAITWVPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYCNTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIESLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVSQRSNS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28.3
UniProt: P0C6Z5
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.