Glycoprotein C, Recombinant, Human herpesvirus 1, aa267-359, His-KSI-Tag

Catalog Number: USB-584710
Article Name: Glycoprotein C, Recombinant, Human herpesvirus 1, aa267-359, His-KSI-Tag
Biozol Catalog Number: USB-584710
Supplier Catalog Number: 584710
Alternative Catalog Number: USB-584710-20,USB-584710-100
Manufacturer: US Biological
Category: Molekularbiologie
Major attachment protein that mediates binding of the virus to cell surface heparan sulfate or chondroitin sulfate. Plays also several roles in host immune evasion by inhibiting the host complement cascade activation, and by providing a shield against neutralizing antibodies that interfere with gB-gD, gB-gH/gL or gD-gH/gL interactions. Source: Recombinant protein corresponding to aa267-359 from human herpesvirus 1 Glycoprotein C, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.8kD Amino Acid Sequence: PSLTLQPHAVMEGQPFKATCTAAAYYPRNPVEFDWFEDDRQVFNPGQIDTQTHEHPDGFTTVSTVTSEAVGGQVPPRTFTCQMTWHRDSVTFS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 25.8
UniProt: P28986
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.