Glyoxylate/hydroxypyruvate Reductase A, Recombinant, E. coli, aa1-312

Catalog Number: USB-584724
Article Name: Glyoxylate/hydroxypyruvate Reductase A, Recombinant, E. coli, aa1-312
Biozol Catalog Number: USB-584724
Supplier Catalog Number: 584724
Alternative Catalog Number: USB-584724-20,USB-584724-100
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the NADPH-dependent reduction of glyoxylate and hydroxypyruvate into glycolate and glycerate, respectively. Full length recombinant protein corresponding to aa1-312 from Escherichia coli Glyoxylate/hydroxypyruvate reductase A, expressed in E.coli. Molecular Weight: ~35.4kD Amino Acid Sequence: MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAVFALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQQNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAGREELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAALDSGKVKGAMLDVFNREPLPPENPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGERVCGQVDRARGY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.4
UniProt: B7LFE3
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.