Granulin-3, Recombinant, Cyprinus carpio, aa1-57, His-Tag, Myc-Tag

Catalog Number: USB-584736
Article Name: Granulin-3, Recombinant, Cyprinus carpio, aa1-57, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584736
Supplier Catalog Number: 584736
Alternative Catalog Number: USB-584736-20,USB-584736-100
Manufacturer: US Biological
Category: Molekularbiologie
Granulins have possible cytokine-like activity. They may play a role in inflammation, wound repair, and tissue remodeling. Source: Recombinant protein corresponding to aa1-57 from Cyprinus carpio Granulin-3, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~13.3kD Amino Acid Sequence: VVFCDAGITCPSGTTCCRSPFGVWYCCPFLMGQCCRDGRHCCRHGYHCDSTSTLCLR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 13.3
UniProt: P81015
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.