Granulocyte Colony-stimulating Factor, Recombinant, Human, aa27-200, His-Tag

Catalog Number: USB-584737
Article Name: Granulocyte Colony-stimulating Factor, Recombinant, Human, aa27-200, His-Tag
Biozol Catalog Number: USB-584737
Supplier Catalog Number: 584737
Alternative Catalog Number: USB-584737-20, USB-584737-100
Manufacturer: US Biological
Category: Molekularbiologie
Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes. Source: Recombinant protein corresponding to aa27-200 from human Granulocyte colony-stimulating factor, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~22.6kD Amino Acid Sequence: VQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.6
UniProt: P09919
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.