Granzyme A, Recombinant, Mouse, aa29-260, His-Tag

Catalog Number: USB-584742
Article Name: Granzyme A, Recombinant, Mouse, aa29-260, His-Tag
Biozol Catalog Number: USB-584742
Supplier Catalog Number: 584742
Alternative Catalog Number: USB-584742-20,USB-584742-100
Manufacturer: US Biological
Category: Molekularbiologie
Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent cell death with morphological features of apoptosis when delivered into the target cell through the immunological synapse. It cleaves after Lys or Arg. Cleaves APEX1 after Lys-31 and destroys its oxidative repair activity. Cleaves the nucleosome assembly protein SET after Lys-189, which disrupts its nucleosome assembly activity and allows the SET complex to translocate into the nucleus to nick and degrade the DNA (By similarity). Source: Recombinant protein corresponding to aa29-260 from mouse Granzyme A, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~31.6kD Amino Acid Sequence: IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 31.6
UniProt: P11032
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.