GRF1-interacting Factor 1, Recombinant, Arabidopsis Thaliana, aa1-210, His-KSI-Tag

Catalog Number: USB-584748
Article Name: GRF1-interacting Factor 1, Recombinant, Arabidopsis Thaliana, aa1-210, His-KSI-Tag
Biozol Catalog Number: USB-584748
Supplier Catalog Number: 584748
Alternative Catalog Number: USB-584748-20,USB-584748-100
Manufacturer: US Biological
Category: Molekularbiologie
Transcription coactivator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. Appears to function synergistically with GRF1 as a transcriptional coactivator. Acts together with GRF5 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. Plays a role in adaxial/abaxial patterning and growth in leaf morphogenesis. GIFs are involved in the positive regulation of cell proliferation of lateral organs in a functionally redundant manner. Together with GATA18/HAN, mediates cotyledon identity by preventing ectopic root formation through the repression of PLT1 expression. Source: Recombinant protein corresponding to aa1-210 from Arabidopsis thaliana GRF1-interacting factor 1, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~37.8kD Amino Acid Sequence: MQQHLMQMQPMMAGYYPSNVTSDHIQQYLDENKSLILKIVESQNSGKLSECAENQARLQRNLMYLAAIADSQPQPPSVHSQYGSAGGGMIQGEGGSHYLQQQQATQQQQMTQQSLMAARSSMLYAQQQQQQQPYATLQHQQLHHSQLGMSSSSGGGGSSGLHILQGEAGGFHDFGRGKPEMGSGGGGEGRGGSSGDGGETLYLKSSDDGN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 37.8
UniProt: Q8L8A5
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.