GTP:AMP Phosphotransferase, Mitochondrial, Recombinant, Human, aa1-227, His-Tag, Myc-Tag

Catalog Number: USB-584764
Article Name: GTP:AMP Phosphotransferase, Mitochondrial, Recombinant, Human, aa1-227, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584764
Supplier Catalog Number: 584764
Alternative Catalog Number: USB-584764-20,USB-584764-200
Manufacturer: US Biological
Category: Molekularbiologie
Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities. Source: Recombinant protein corresponding to aa1-227 from human GTP:AMP phosphotransferase, mitochondrial, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~32.6kD Amino Acid Sequence: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 32.6
UniProt: Q9UIJ7
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.