Guanylate Cyclase Soluble Subunit Alpha-2, Recombinant, Human, aa500-732, His-Tag

Catalog Number: USB-584773
Article Name: Guanylate Cyclase Soluble Subunit Alpha-2, Recombinant, Human, aa500-732, His-Tag
Biozol Catalog Number: USB-584773
Supplier Catalog Number: 584773
Alternative Catalog Number: USB-584773-20,USB-584773-100
Manufacturer: US Biological
Category: Molekularbiologie
Has guanylyl cyclase on binding to the beta-1 subunit., Isoform 2 acts as a negative regulator of guanylyl cyclase activity as it forms non-functional heterodimers with the beta subunits. Source: Recombinant protein corresponding to aa500-732 from human Guanylate cyclase soluble subunit alpha-2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~27.8kD Amino Acid Sequence: GDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSPTTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKPPKPSLSSSRIKKVSYNIGTMFLRETSL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.8
UniProt: P33402
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.