Heat Shock Protein 21, Recombinant, Arabidopsis thaliana, aa44-227, His-Tag, Myc-Tag, chloroplastic

Catalog Number: USB-584783
Article Name: Heat Shock Protein 21, Recombinant, Arabidopsis thaliana, aa44-227, His-Tag, Myc-Tag, chloroplastic
Biozol Catalog Number: USB-584783
Supplier Catalog Number: 584783
Alternative Catalog Number: USB-584783-20,USB-584783-100
Manufacturer: US Biological
Category: Molekularbiologie
Chaperone protein required for seedling and chloroplast development under heat stress, probably by maintaining plastid-encoded RNA polymerase (PEP)-dependent transcription. Source: Recombinant protein corresponding to aa44-227 from Arabidopsis thaliana Heat shock protein 21, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~28.4kD Amino Acid Sequence: AQDQRENSIDVVQQGQQKGNQGSSVEKRPQQRLTMDVSPFGLLDPLSPMRTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAELKNGVLFITIPKTKVERKVIDVQIQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28.4
UniProt: P31170
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.