Heat Shock Protein SSA1, Recombinant, Saccharomyces cerevisiae, aa443-642, His-Tag, Myc-Tag

Product Overview

• Article Name: Heat Shock Protein SSA1, Recombinant, Saccharomyces cerevisiae, aa443-642, His-Tag, Myc-Tag
• Biozol Catalog Number: USB-584788
• Supplier Catalog Number: 584788
• Alternative Catalog Number: USB-584788-20,USB-584788-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May play a role in the transport of polypeptides both across the mitochondrial membranes and into the endoplasmic reticulum. A functional difference between SSA1 and SSA2 proteins is expected. SSA1 can participate in the ATP-dependent disassembly of clathrin-coated vesicles. Source: Recombinant protein corresponding to aa443-642 from Saccharomyces cerevisiae Heat shock protein SSA1, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~28.3kD Amino Acid Sequence: ERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 28.3
• UniProt: P10591
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.