Hemagglutinin-neuraminidase, Recombinant, Newcastle Disease Virus, aa115-473, His-Tag, Myc-Tag

Catalog Number: USB-584805
Article Name: Hemagglutinin-neuraminidase, Recombinant, Newcastle Disease Virus, aa115-473, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584805
Supplier Catalog Number: 584805
Alternative Catalog Number: USB-584805-20,USB-584805-100
Manufacturer: US Biological
Category: Molekularbiologie
Mediates the viral entry into the host cell together with fusion/F protein. Attaches the virus to sialic acid-containing cell receptors and thereby initiates infection. Binding of HN protein to the receptor induces a conformational change that allows the F protein to trigger virion/cell membranes fusion., Neuraminidase activity ensures the efficient spread of the virus by dissociating the mature virions from the neuraminic acid containing glycoproteins. Source: Recombinant protein corresponding to aa115-473 from Newcastle disease virus Hemagglutinin-neuraminidase, fused to 6X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~42.7kD Amino Acid Sequence: NGAANNSGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDISATHYCYTHNVILSGCRDHSHSHQYLALGVLRTSATGRVFFSTLRSINLDDNQNRKSCSVSATPLGCDMLCSKITETEEEDYSSVTPTSMVHGRLGFDGQYHEKDLDVITLFKDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTVQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTIPPNTVTLMGAEGRVLTVGTSHFLYQRGSSYFSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 42.7
UniProt: P35741
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.