Hemolysin E, Chromosomal, Recombinant, E. coli, aa2-182, His-Tag
Biozol Catalog Number:
USB-584821
Supplier Catalog Number:
584821
Alternative Catalog Number:
USB-584821-20,USB-584821-100,USB-584821-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Toxin, which has some hemolytic activity towards mammalian cells. Acts by forming a pore-like structure upon contact with mammalian cells. Recombinant protein corresponding to aa2-182 from Escherichia coli Hemolysin E, chromosomal, fused to 6X His-Tag at C-terminal, expressed in E. coli. Accession: P77335 Molecular Weight: ~21.2kD Amino Acid Sequence: TEIVADKTVEVVKNAIETADGALDLYNKYLDQVIPWQTFDETIKELSRFKQEYSQAASVLVGDIKTLLMDSQDKYFEATQTVYEWCGVATQLLAAYILLFDEYNEKKASAQKDILIKVLDDGITKLNEAQKSLLVSSQSFNNASGKLLALDSQLTNDFSEKSSYFQSQVDKIRKEAYAGAA Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
