Heterogeneous Nuclear Ribonucleoprotein H, Recombinant, Human, aa2-216, GST-Tag

Catalog Number: USB-584834
Article Name: Heterogeneous Nuclear Ribonucleoprotein H, Recombinant, Human, aa2-216, GST-Tag
Biozol Catalog Number: USB-584834
Supplier Catalog Number: 584834
Alternative Catalog Number: USB-584834-20, USB-584834-100
Manufacturer: US Biological
Category: Molekularbiologie
This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG). Source: Recombinant protein corresponding to aa2-216 from human Heterogeneous nuclear ribonucleoprotein H, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~51.2kD Amino Acid Sequence: MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYDRPGAG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 51.2
UniProt: P31943
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.