High Affinity Transport System Protein p37, Recombinant, Mycoplasma genitalium, aa26-368, His-Tag, Myc-Tag

Catalog Number: USB-584845
Article Name: High Affinity Transport System Protein p37, Recombinant, Mycoplasma genitalium, aa26-368, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584845
Supplier Catalog Number: 584845
Alternative Catalog Number: USB-584845-20, USB-584845-100
Manufacturer: US Biological
Category: Molekularbiologie
P37 is part of a high-affinity transport system. Source: Recombinant protein corresponding to aa26-368 from Mycoplasma genitalium High affinity transport system protein p37, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~44.4kD Amino Acid Sequence: CATKSDNTLIFNISLDHNADTSIEKFFTVFSKKLSGKLNKKINVNFNIVDDSFTKINNIQANKADFAFVNSQAIASNNWFGYTPLIQTLTTAFKEDLELDYYEDGNLQKKAEKTNLLFLSPPYKEWDDIKQKWTGNRYDFLYEPSKLVSFYRSMILITGSASEITAIKKAWNEKNWNQFMKFGIGHGQTNSASRFELPDLLFRKHFAKNYPGLQNAINSDPDKFAVVRGREIGINKNIKIVFDDANSFSWTQNIKGSKRPFYTPIDPNDRLEILTYSDPLLYDIGIVSNNLSRIYQKAIGEIFIELAQSSEDLYGPSIGYNGYKMINDFEKEVVEIIEKTYGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 44.4
UniProt: Q49410
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.