Histone Deacetylase 4, Recombinant, Human, aa1-227, GST-Tag

Catalog Number: USB-584853
Article Name: Histone Deacetylase 4, Recombinant, Human, aa1-227, GST-Tag
Biozol Catalog Number: USB-584853
Supplier Catalog Number: 584853
Alternative Catalog Number: USB-584853-20,USB-584853-100
Manufacturer: US Biological
Category: Molekularbiologie
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation via its interaction with the myocyte enhancer factors such as MEF2A, MEF2C and MEF2D. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. Deacetylates HSPA1A and HSPA1B at Lys-77 leading to their preferential binding to co-chaperone STUB1. Source: Recombinant protein corresponding to aa1-227 from human Histone deacetylase 4, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~53.3kD Amino Acid Sequence: MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNH Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 53.3
UniProt: P56524
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in Tris, 50% glycerol