HLA Class II Histocompatibility Antigen, DM beta chain, Recombinant, Human, aa19-218, His-Tag

Product Overview

• Article Name: HLA Class II Histocompatibility Antigen, DM beta chain, Recombinant, Human, aa19-218, His-Tag
• Biozol Catalog Number: USB-584871
• Supplier Catalog Number: 584871
• Alternative Catalog Number: USB-584871-20, USB-584871-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Source: Recombinant protein corresponding to aa19-218 from human HLA class II histocompatibility antigen, DM beta chain, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~26.4kD Amino Acid Sequence: GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 26.4
• UniProt: P28068
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.