Holo-[acyl-carrier-protein] Synthase, Recombinant, Streptococcus agalactiae serotype III, aa1-119, His-Tag, Myc-Tag
Biozol Catalog Number:
USB-584878
Supplier Catalog Number:
584878
Alternative Catalog Number:
USB-584878-20,USB-584878-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Transfers the 4-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. Source: Recombinant protein corresponding to aa1-119 from Streptococcus agalactiae serotype III Holo-[acyl-carrier-protein] synthase, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~20.7kD Amino Acid Sequence: MIVGHGIDLQEIEAITKAYERNQRFAERVLTEQELLLFKGISNPKRQMSFLTGRWAAKEAYSKALGTGIGKVNFHDIEILSDDKGAPLITKEPFNGKSFVSISHSGNYAQASVILEEEK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted