Homeobox Protein Hox-A2, Recombinant, Human, aa26-124, His-Tag

Catalog Number: USB-584880
Article Name: Homeobox Protein Hox-A2, Recombinant, Human, aa26-124, His-Tag
Biozol Catalog Number: USB-584880
Supplier Catalog Number: 584880
Alternative Catalog Number: USB-584880-20,USB-584880-100
Manufacturer: US Biological
Category: Molekularbiologie
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Source: Recombinant protein corresponding to aa26-124 from human Homeobox protein Hox-A2, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12kD Amino Acid Sequence: PPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAGGRPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 12
UniProt: O43364
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.