Homeobox Protein OTX2, Recombinant, Mouse, aa1-289, His-Tag

Product Overview

• Article Name: Homeobox Protein OTX2, Recombinant, Mouse, aa1-289, His-Tag
• Biozol Catalog Number: USB-584888
• Supplier Catalog Number: 584888
• Alternative Catalog Number: USB-584888-20, USB-584888-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS). Source: Recombinant protein corresponding to aa1-289 from mouse Homeobox protein OTX2, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~37.6kD Amino Acid Sequence: MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKSSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 37.6
• UniProt: P80206
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.