Hyaluronan and Proteoglycan Link Protein 4, Recombinant, Human, aa30-402, His-Tag

Catalog Number: USB-584902
Article Name: Hyaluronan and Proteoglycan Link Protein 4, Recombinant, Human, aa30-402, His-Tag
Biozol Catalog Number: USB-584902
Supplier Catalog Number: 584902
Alternative Catalog Number: USB-584902-20,USB-584902-100
Manufacturer: US Biological
Category: Molekularbiologie
Binds to hyaluronic acid and may be involved in formation of the extracellular matrix. Source: Recombinant protein corresponding to aa30-402 from human Hyaluronan and proteoglycan link protein 4, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~43.7kD Amino Acid Sequence: QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLHV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 43.7
UniProt: Q86UW8
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.