Indiana Virus Phosphoprotein, Recombinant, Vesicular stomatitis, aa1-265, His-Tag, Myc-Tag

Catalog Number: USB-584949
Article Name: Indiana Virus Phosphoprotein, Recombinant, Vesicular stomatitis, aa1-265, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584949
Supplier Catalog Number: 584949
Alternative Catalog Number: USB-584949-20,USB-584949-100
Manufacturer: US Biological
Category: Molekularbiologie
Essential component of the RNA polymerase transcription and replication complex. Binds the viral ribonucleocapsid and positions the L polymerase on the template. May act as a chaperone for newly synthesized free N protein, so-called N(0). Plays a role in virion assembly. Full length recombinant protein corresponding to aa1-265 from Vesicular stomatitis Indiana virus Phosphoprotein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Swiss/Uniprot: P04879 Molecular Weight: ~34.9kD Amino Acid Sequence: MDNLTKVREYLKSYSRLDQAVGEIDEIEAQRAEKSNYELFQEDGVEEHTRPSYFQAADDSDTESEPEIEDNQGLYVPDPEAEQVEGFIQGPLDDYADDDVDVVFTSDWKQPELESDEHGKTLRLTLPEGLSGEQKSQWLSTIKAVVQSAKHWNLAECTFEASGEGVIIKKRQITPDVYKVTPVMNTHPSQSEAVSDVWSLSKTSMTFQPKKASLQPLTVSLDELFSSRGEFISVGGNGRMSHKEAILLGLRYKKLYNQARVKYSL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 34.9
UniProt: P04879
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.