Indiana Virus Protein C, Recombinant, Vesicular stomatitis, aa1-67, aa1-67, His-Tag

Product Overview

• Article Name: Indiana Virus Protein C, Recombinant, Vesicular stomatitis, aa1-67, aa1-67, His-Tag
• Biozol Catalog Number: USB-584950
• Supplier Catalog Number: 584950
• Alternative Catalog Number: USB-584950-20,USB-584950-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May play a role in viral pathogenesis or transmission by insects vectors. Source: Recombinant protein corresponding to aa1-67 from Indiana virus Protein C Vesicular stomatitis, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~11.9kD Amino Acid Sequence: MRSKHNELKSPIMSCSKRTEWKSILGPLIFRQQMILTQNLNQKLKTIKACMYQIRKLSKLKALYRGL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 11.9
• UniProt: Q86132
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.