Inducible T-cell Costimulator, Recombinant, Rat, aa21-145, His-Tag

Catalog Number: USB-584952
Article Name: Inducible T-cell Costimulator, Recombinant, Rat, aa21-145, His-Tag
Biozol Catalog Number: USB-584952
Supplier Catalog Number: 584952
Alternative Catalog Number: USB-584952-20,USB-584952-100
Manufacturer: US Biological
Category: Molekularbiologie
Enhances all basic T-cell responses to a foreign antigen, namely proliferation, secretion of lymphokines, up-regulation of molecules that mediate cell-cell interaction, and effective help for antibody secretion by B-cells. Essential both for efficient interaction between T and B-cells and for normal antibody responses to T-cell dependent antigens. Does not up-regulate the production of interleukin-2, but superinduces the synthesis of interleukin-10. Prevents the apoptosis of pre-activated T-cells. Plays a critical role in CD40-mediated class switching of immunoglobin isotypes. Source: Recombinant protein corresponding to aa21-145 from rat Inducible T-cell costimulator, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~18.1kD Amino Acid Sequence: ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCCQLKLWLP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 18.1
UniProt: Q9R1T7
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.