Insulin-like Growth Factor-binding Protein 3 Receptor, Recombinant, Human, aa39-204, His-Tag, Myc-Tag

Catalog Number: USB-584971
Article Name: Insulin-like Growth Factor-binding Protein 3 Receptor, Recombinant, Human, aa39-204, His-Tag, Myc-Tag
Biozol Catalog Number: USB-584971
Supplier Catalog Number: 584971
Alternative Catalog Number: USB-584971-20,USB-584971-100
Manufacturer: US Biological
Category: Molekularbiologie
Cell death receptor specific for IGFBP3, may mediate caspase-8-dependent apoptosis upon ligand binding. Source: Recombinant protein corresponding to aa39-204 from human Insulin-like growth factor-binding protein 3 receptor, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~22.7kD Amino Acid Sequence: SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.7
UniProt: Q86XT9
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.