Integration Host Factor Subunit Beta, Recombinant, Neisseria Meningitidis Serogroup B, aa1-104, His-Tag

Catalog Number: USB-584976
Article Name: Integration Host Factor Subunit Beta, Recombinant, Neisseria Meningitidis Serogroup B, aa1-104, His-Tag
Biozol Catalog Number: USB-584976
Supplier Catalog Number: 584976
Alternative Catalog Number: USB-584976-20,USB-584976-100
Manufacturer: US Biological
Category: Molekularbiologie
This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control. Source: Recombinant protein corresponding to aa1-100 from Neisseria meningitidis serogroup B Integration host factor subunit beta, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~17.8kD Amino Acid Sequence: MTKSELMVRLAEVFAAKNGTHLLAKDVEYSVKVLVDTMTRSLARGQRIEIRGFGSFDLNHRPARIGRNPKTGERVEVPEKHVPHFKPGKELRERVDLALKENAN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.8
UniProt: P0A0U2
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.