Inter-alpha-trypsin Inhibitor Heavy Chain H3, Recombinant, Human, aa512-651, His-GST-Tag, Myc-Tag

Product Overview

• Article Name: Inter-alpha-trypsin Inhibitor Heavy Chain H3, Recombinant, Human, aa512-651, His-GST-Tag, Myc-Tag
• Biozol Catalog Number: USB-584986
• Supplier Catalog Number: 584986
• Alternative Catalog Number: USB-584986-20,USB-584986-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes. Source: Recombinant protein corresponding to aa512-651 from human Inter-alpha-trypsin inhibitor heavy chain H3, fused to 10X His-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~51.2kD Amino Acid Sequence: MNSFKADVKGHGATNDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 51.2
• UniProt: Q06033
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.