Inter-alpha-Trypsin Inhibitor Heavy Chain H4, Recombinant, Human, aa689-930, His-Tag
Biozol Catalog Number:
USB-584987
Supplier Catalog Number:
584987
Alternative Catalog Number:
USB-584987-20
Manufacturer:
US Biological
Category:
Molekularbiologie
Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration. Source: Recombinant protein corresponding to aa689-930 from human Inter-alpha-trypsin inhibitor heavy chain H4, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~28.9kD Amino Acid Sequence: RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.