Interferon gamma, Recombinant, Mouse, aa27-155, His-Tag

Catalog Number: USB-584996
Article Name: Interferon gamma, Recombinant, Mouse, aa27-155, His-Tag
Biozol Catalog Number: USB-584996
Supplier Catalog Number: 584996
Alternative Catalog Number: USB-584996-20,USB-584996-100
Manufacturer: US Biological
Category: Molekularbiologie
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. Source: Recombinant protein corresponding to aa27-155 from mouse Interferon gamma, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~19.1kD Amino Acid Sequence: IESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 19.1
UniProt: P01580
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.