Interferon Gamma, Recombinant, Rat, aa23-156, GST-Tag

Product Overview

• Article Name: Interferon Gamma, Recombinant, Rat, aa23-156, GST-Tag
• Biozol Catalog Number: USB-584997
• Supplier Catalog Number: 584997
• Alternative Catalog Number: USB-584997-20,USB-584997-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. Source: Recombinant protein corresponding to aa23-156 from rat Interferon gamma, fused to GST-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~42.5kD Amino Acid Sequence: QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 42.5
• UniProt: P01581
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.