Interleukin-11, Recombinant, Rat, aa22-199, MBP-Tag, His-Avi-Tag, Biotinylated

Catalog Number: USB-585025
Article Name: Interleukin-11, Recombinant, Rat, aa22-199, MBP-Tag, His-Avi-Tag, Biotinylated
Biozol Catalog Number: USB-585025
Supplier Catalog Number: 585025
Alternative Catalog Number: USB-585025-20,USB-585025-100
Manufacturer: US Biological
Category: Molekularbiologie
Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and IL11RA activates a signaling cascade that promotes cell proliferation. Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3. The interaction with the membrane-bound IL11RA and IL6ST stimulates classic signaling, whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates trans-signaling. Source: Recombinant protein corresponding to aa22-199 from rat Interleukin-11, fused to MBP-Tag at N-terminal and 6X His-Avi-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~67.0kD Amino Acid Sequence: PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 67
UniProt: Q99MF5
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.