Interleukin-20 Receptor Subunit beta, Recombinant, Human, aa30-233, His-Tag

Catalog Number: USB-585041
Article Name: Interleukin-20 Receptor Subunit beta, Recombinant, Human, aa30-233, His-Tag
Biozol Catalog Number: USB-585041
Supplier Catalog Number: 585041
Alternative Catalog Number: USB-585041-20,USB-585041-100,USB-585041-1
Manufacturer: US Biological
Category: Molekularbiologie
The IL20RA/IL20RB dimer is a receptor for IL19, IL20 and IL24. The IL22RA1/IL20RB dimer is a receptor for IL20 and IL24. Source: Recombinant protein corresponding to aa30-233 from human Interleukin-20 receptor subunit beta, fused to 6X His-Tag, at N-terminal, expressed in E.coli. Molecular Weight: ~26.9kD Amino Acid Sequence: DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.9
UniProt: Q6UXL0
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.