Iron-sulfur Cluster Assembly Enzyme ISCU, Mitochondrial, Recombinant, Human, aa35-167, His-SUMOSTAR-Tag

Catalog Number: USB-585082
Article Name: Iron-sulfur Cluster Assembly Enzyme ISCU, Mitochondrial, Recombinant, Human, aa35-167, His-SUMOSTAR-Tag
Biozol Catalog Number: USB-585082
Supplier Catalog Number: 585082
Alternative Catalog Number: USB-585082-20,USB-585082-100
Manufacturer: US Biological
Category: Molekularbiologie
Scaffold protein for the de novo synthesis of iron-sulfur (Fe-S) clusters within mitochondria, which is required for maturation of both mitochondrial and cytoplasmic Functions as a cytoplasmic scaffold protein for the de novo synthesis of iron-sulfur clusters in the cytoplasm. Source: Recombinant protein corresponding to aa35-167 from human Iron-sulfur cluster assembly enzyme ISCU, mitochondrial, fused to 6X His-SUMOSTAR-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.5kD Amino Acid Sequence: YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.5
UniProt: Q9H1K1
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.