Isoleucine--tRNA Ligase, Cytoplasmic, Recombinant, Human, aa693-852, His-Tag, Myc-Tag

Catalog Number: USB-585087
Article Name: Isoleucine--tRNA Ligase, Cytoplasmic, Recombinant, Human, aa693-852, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585087
Supplier Catalog Number: 585087
Alternative Catalog Number: USB-585087-20,USB-585087-100
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA. Source: Recombinant protein corresponding to aa693-852 from human Isoleucine--tRNA ligase, cytoplasmic, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~26.3kD Amino Acid Sequence: DRWILSFMQSLIGFFETEMAAYRLYTVVPRLVKFVDILTNWYVRMNRRRLKGENGMEDCVMALETLFSVLLSLCRLMAPYTPFLTELMYQNLKVLIDPVSVQDKDTLSIHYLMLPRVREELIDKKTESAVSQMQSVIELGRVIRDRKTIPIKYPLKEIVV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.3
UniProt: P41252
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.