Keratin, Type I Cytoskeletal 10, Recombinant, Human, aa326-443, His-Tag

Catalog Number: USB-585104
Article Name: Keratin, Type I Cytoskeletal 10, Recombinant, Human, aa326-443, His-Tag
Biozol Catalog Number: USB-585104
Supplier Catalog Number: 585104
Alternative Catalog Number: USB-585104-20,USB-585104-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays a role in the establishment of the epidermal barrier on plantar skin., (Microbial infection) Acts as a mediator of S.aureus adherence to desquamated nasal epithelial cells via clfB, and hence may play a role in nasal colonization., (Microbial infection) Binds S.pneumoniae PsrP, mediating adherence of the bacteria to lung cell lines. Reduction of levels of KRT10 keratin decrease adherence, overexpression increases adherence. Neither protein has to be glycosylated for the interaction to occur. Source: Recombinant protein corresponding to aa326-443 from human KeRatin, type I cytoskeletal 10, fused to 6X His-Tag at C-terminal, expressed in Yeast. Molecular Weight: ~15.7kD Amino Acid Sequence: EQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 15.7
UniProt: P13645
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.