Killer Cell Immunoglobulin-like Receptor 2DS3, Recombinant, Human, aa22-245, His-SUMO-Tag, Myc-Tag

Catalog Number: USB-585118
Article Name: Killer Cell Immunoglobulin-like Receptor 2DS3, Recombinant, Human, aa22-245, His-SUMO-Tag, Myc-Tag
Biozol Catalog Number: USB-585118
Supplier Catalog Number: 585118
Alternative Catalog Number: USB-585118-20,USB-585118-100,USB-585118-1
Manufacturer: US Biological
Category: Molekularbiologie
Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. Source: Recombinant protein corresponding to aa22-245 from human Killer cell immunoglobulin-like receptor 2DS3, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~44.7kD Amino Acid Sequence: HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 44.7
UniProt: Q14952
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.