Kinase Suppressor of Ras 1, Recombinant, Human, aa404-598, His-Tag

Product Overview

• Article Name: Kinase Suppressor of Ras 1, Recombinant, Human, aa404-598, His-Tag
• Biozol Catalog Number: USB-585122
• Supplier Catalog Number: 585122
• Alternative Catalog Number: USB-585122-20,USB-585122-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Scaffolding protein that is part of a multiprotein signaling complex. Promotes phosphorylation of Raf family members and activation of downstream MAP kinases. Promotes activation of MAPK1 and/or MAPK3, both in response to EGF and to cAMP. Does not have kinase activity by itself. Source: Recombinant protein corresponding to aa404-598 from human Kinase suppressor of Ras 1, 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~25.0kD Amino Acid Sequence: TESVPSDINNPVDRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAESLKENAFNISAFAHAAPLPEAADGTRLDDQPKADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 25
• UniProt: Q8IVT5
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.