L-aspartate Oxidase, Recombinant, Pyrococcus horikoshii, aa1-464, His-SUMO-Tag, Myc-Tag

Catalog Number: USB-585134
Article Name: L-aspartate Oxidase, Recombinant, Pyrococcus horikoshii, aa1-464, His-SUMO-Tag, Myc-Tag
Biozol Catalog Number: USB-585134
Supplier Catalog Number: 585134
Alternative Catalog Number: USB-585134-20,USB-585134-100
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the oxidation of L-aspartate to iminoaspartate. Source: Recombinant protein corresponding to aa1-464 from Pyrococcus horikoshii L-aspartate oxidase, fused to 10X His-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~71.3kD Amino Acid Sequence: MMEMRVGIVGGGLAGLTAAIALAEKGFDVSIIGPRSTDSNSYLAQAGIALPLLEGDSIRIHVLDTIKAGKYINDEEIVWNVISKSSEAHDFLTSHGVTFTGNELEGGHSYPRIFTIKSETGKHIIPILEKHARELDVNFIRGFVEEIGINNGKLAGVFLQGELLKFDAVVIAAGGFSGLYRFTAGVKNNIGLLIGDVALKGVPLRDMEFVQFHPTGFIGKRTYLITEAVRGAGAKLVTGDGERFVNELETRDIVARAIYMKMLEGKGVFLDARGIENFKDRFPYIYSVLRGEGINPEKDLIPITPVAHYTIGGISVDAFYRTRIKGLYAIGESACNGFHGANRLASNSLLECVVSGLEVARTISREKPKREVNDAPYSFNELGDVDSIREVLWNHAGIVRDEWSLREGLRKLKEIEVDERLKLVAKAVIISALKREESRGAHYRKDYPFMRKEFEHSSFFYPNV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 71.3
UniProt: O57765
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.