L-lactate Dehydrogenase C Chain, Recombinant, Human, aa2-332, His-Tag

Catalog Number: USB-585136
Article Name: L-lactate Dehydrogenase C Chain, Recombinant, Human, aa2-332, His-Tag
Biozol Catalog Number: USB-585136
Supplier Catalog Number: 585136
Alternative Catalog Number: USB-585136-20,USB-585136-100
Manufacturer: US Biological
Category: Molekularbiologie
Possible role in sperm motility. Source: Recombinant protein corresponding to aa2-332 from human L-lactate dehydrogenase C chain, fused to 6X His-Tag at N-terminal, expressed in Baculovirus. Molecular Weight: ~38.2kD Amino Acid Sequence: STVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKISGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKEHWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGVSDVVKINLNSEEEALFKKSAETLWNIQKDLIF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 38.2
UniProt: P07864
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.