Large Cysteine-rich Periplasmic Protein OmcB, Recombinant, Chlamydia Pneumoniae, aa41-196, His-SUMO-Tag

Product Overview

• Article Name: Large Cysteine-rich Periplasmic Protein OmcB, Recombinant, Chlamydia Pneumoniae, aa41-196, His-SUMO-Tag
• Biozol Catalog Number: USB-585152
• Supplier Catalog Number: 585152
• Alternative Catalog Number: USB-585152-20,USB-585152-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the small cysteine-rich protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan. Source: Recombinant protein corresponding to aa41-196 from Chlamydia pneumoniae Large cysteine-rich periplasmic protein OmcB, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~33.3kD Amino Acid Sequence: SAETKPAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSVKVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 33.3
• UniProt: P23700
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.