Leukocyte Immunoglobulin-like Receptor Subfamily A Member 5, Recombinant, Human, aa42-268, His-Tag
Biozol Catalog Number:
USB-585190
Supplier Catalog Number:
585190
Alternative Catalog Number:
USB-585190-20,USB-585190-100
Manufacturer:
US Biological
Category:
Molekularbiologie
May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition. Source: Recombinant protein corresponding to aa42-268 from human Leukocyte immunoglobulin-like receptor subfamily A member 5, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~29.2kD Amino Acid Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted