Lingual Antimicrobial Peptide, Recombinant, Bubalus bubalis, aa25-64, His-KSI-Tag

Catalog Number: USB-585199
Article Name: Lingual Antimicrobial Peptide, Recombinant, Bubalus bubalis, aa25-64, His-KSI-Tag
Biozol Catalog Number: USB-585199
Supplier Catalog Number: 585199
Alternative Catalog Number: USB-585199-20, USB-585199-100
Manufacturer: US Biological
Category: Molekularbiologie
Has bactericidal activity. Source: Recombinant protein corresponding to aa25-64 from Bubalus bubalis Lingual antimicrobial peptide, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~19.8kD Amino Acid Sequence: VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 19.8
UniProt: A3RJ36
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.