Lipoarabinomannan Carrier Protein LprG, Recombinant, Mycobacterium Tuberculosis, aa27-236, His-Tag, Myc-Tag

Catalog Number: USB-585200
Article Name: Lipoarabinomannan Carrier Protein LprG, Recombinant, Mycobacterium Tuberculosis, aa27-236, His-Tag, Myc-Tag
Biozol Catalog Number: USB-585200
Supplier Catalog Number: 585200
Alternative Catalog Number: USB-585200-20, USB-585200-100
Manufacturer: US Biological
Category: Molekularbiologie
Probably helps membrane protein MT1454 (P55) transport triacylglycerides (TAG) across the inner cell membrane into the periplasm and probably ultimately to the outer membrane. TAG probably regulates lipid metabolism and growth regulation. Binds di- and triacylated phosphatidyl-myo-inositol mannosides (PIMs), and glycolipid lipoglycan modulins lipoarabinomannan (LAM) and lipomannan (LM), facilitating their recognition by TLR2. Required for activity of drug efflux transporter MT1454. Required, probably with MT1454, for normal surface localization of LAM., Constitutes a host TLR2 agonist (toll-like receptor). Source: Recombinant protein corresponding to aa27-236 from Mycobacterium tuberculosis Lipoarabinomannan carrier protein LprG, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Molecular Weight: ~29.2kD Amino Acid Sequence: CSSGSKPSGGPLPDAKPLVEEATAQTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDIDADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLANFADAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETGDHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.2
UniProt: P9WK44
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.