Lipopolysaccharide Export System Protein LptC, Recombinant, E. coli O6:H1, aa1-191, His-Tag
Biozol Catalog Number:
USB-585203
Supplier Catalog Number:
585203
Alternative Catalog Number:
USB-585203-20,USB-585203-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Involved in the assembly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner membrane to the outer membrane. Facilitates the transfer of LPS from the inner membrane to the periplasmic protein LptA. Could be a docking site for LptA. Source: Recombinant protein corresponding to aa1-191 from Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~23.7kD Amino Acid Sequence: MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted