Lipopolysaccharide-binding Protein, Recombinant, Human, aa304-414, His-GST-Tag, Myc-Tag

Catalog Number: USB-585205
Article Name: Lipopolysaccharide-binding Protein, Recombinant, Human, aa304-414, His-GST-Tag, Myc-Tag
Biozol Catalog Number: USB-585205
Supplier Catalog Number: 585205
Alternative Catalog Number: USB-585205-20,USB-585205-100,USB-585205-1
Manufacturer: US Biological
Category: Molekularbiologie
Plays a role in the innate immune response. Binds to the lipid A moiety of bacterial lipopolysaccharides (LPS), a glycolipid present in the outer membrane of all Gram-negative bacteria. Acts as an affinity enhancer for CD14, facilitating its association with LPS. Promotes the release of cytokines in response to bacterial lipopolysaccharide. Partial recombinant protein corresponding to aa304-414 from human Lipopolysaccharide-binding protein, fused to 10X His-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E.coli. Swiss/UniProt Accession: P18428. Molecular Weight: ~47.4kD Amino Acid Sequence: TDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKES Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 47.4
UniProt: P18428
Purity: 85% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCL, pH 8.0, 1mM EDTA, 50% glycerol.