Low Affinity Immunoglobulin Gamma Fc Region Receptor III, Recombinant, Mouse, aa31-215, His-SUMO-Tag

Catalog Number: USB-585218
Article Name: Low Affinity Immunoglobulin Gamma Fc Region Receptor III, Recombinant, Mouse, aa31-215, His-SUMO-Tag
Biozol Catalog Number: USB-585218
Supplier Catalog Number: 585218
Alternative Catalog Number: USB-585218-20,USB-585218-100
Manufacturer: US Biological
Category: Molekularbiologie
Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor which binds to IgG1, IgG2a and IgG2b. Mediates neutrophil activation by IgG complexes redundantly with Fcgr4. Source: Recombinant protein corresponding to aa31-215 from mouse Low affinity immunoglobulin gamma Fc region receptor III, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~37.2kD Amino Acid Sequence: ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 37.2
UniProt: P08508
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.