Low Affinity Immunoglobulin Gamma Fc Region Receptor III, Recombinant, Mouse, aa31-215, His-Tag

Product Overview

• Article Name: Low Affinity Immunoglobulin Gamma Fc Region Receptor III, Recombinant, Mouse, aa31-215, His-Tag
• Biozol Catalog Number: USB-585219
• Supplier Catalog Number: 585219
• Alternative Catalog Number: USB-585219-20,USB-585219-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Receptor for the Fc region of complexed immunoglobulins gamma. Low affinity receptor which binds to IgG1, IgG2a and IgG2b. Mediates neutrophil activation by IgG complexes redundantly with Fcgr4. Source: Recombinant protein corresponding to aa31-215 from mouse Low affinity immunoglobulin gamma Fc region receptor III, fused to 6X His-Tag at N-terminal, expressed in Mammalian cell. Molecular Weight: ~25.2kD Amino Acid Sequence: ALPKAVVKLDPPWIQVLKEDMVTLMCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPVDLGVISDWLLLQTPQRVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYKSNFSIPKANHSHSGDYYCKGSLGSTQHQSKPVTITVQDPATTSSISLVWYHT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 25.2
• UniProt: P08508
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.