Low Molecular Weight Phosphotyrosine Protein Phosphatase, Recombinant, Human, aa1-158

Product Overview

• Article Name: Low Molecular Weight Phosphotyrosine Protein Phosphatase, Recombinant, Human, aa1-158
• Biozol Catalog Number: USB-585220
• Supplier Catalog Number: 585220
• Alternative Catalog Number: USB-585220-20,USB-585220-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity. Source: Recombinant protein corresponding to aa1-158 from human Low molecular weight phosphotyrosine protein phosphatase, expressed in E.coli. Molecular Weight: ~18.0kD Amino Acid Sequence: MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 18
• UniProt: P24666
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.