Ly6/PLAUR Domain-containing Protein 3, Recombinant, Human, aa31-326, His-Tag

Product Overview

• Article Name: Ly6/PLAUR Domain-containing Protein 3, Recombinant, Human, aa31-326, His-Tag
• Biozol Catalog Number: USB-585226
• Supplier Catalog Number: 585226
• Alternative Catalog Number: USB-585226-20,USB-585226-100,USB-585226-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Supports cell migration. May be involved in urothelial cell-matrix interactions. May be involved in tumor progression. Source: Recombinant protein corresponding to aa31-326 from human Ly6/PLAUR domain-containing protein 3, fused to 10X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~37.1kD Amino Acid Sequence: LECYSCVQKADDGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGNESAYPPNGVECYSCVGLSREACQGTSPPVVSCYNASDHVYKGCFDGNVTLTAANVTVSLPVRGCVQDEFCTRDGVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYPAKGGPQQPHNKGC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 37.1
• UniProt: O95274
• Purity: 85% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.