Lymphotoxin-alpha, Recombinant, Mouse, aa34-202, His-Tag

Catalog Number: USB-585237
Article Name: Lymphotoxin-alpha, Recombinant, Mouse, aa34-202, His-Tag
Biozol Catalog Number: USB-585237
Supplier Catalog Number: 585237
Alternative Catalog Number: USB-585237-20,USB-585237-100
Manufacturer: US Biological
Category: Molekularbiologie
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and is cytotoxic for a wide range of tumor cells in vitro and in vivo. Source: Recombinant protein corresponding to aa34-202 from mouse Lymphotoxin-alpha, fused to 6X His-Tag at N-terminal, expressed in E.coli. Molecular Weight: ~23.8kD Amino Acid Sequence: LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 23.8
UniProt: P09225
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.